CacheBy
Atlas Antibodies Anti-SLC2A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC2A2 Antibody

상품 한눈에 보기

Human SLC2A2(GLUT2) 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. RNA-seq 데이터 기반 조직 발현 비교로 단백질 발현 검증 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028998-100 Anti-SLC2A2 Antibody, solute carrier family 2 (facilitated glucose transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028998-25 Anti-SLC2A2 Antibody, solute carrier family 2 (facilitated glucose transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC2A2 Antibody

Anti-SLC2A2 Antibody

Target: solute carrier family 2 (facilitated glucose transporter), member 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SLC2A2 (GLUT2).

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: PETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000011875 77%
Mouse ENSMUSG00000027690 74%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.