CacheBy
Atlas Antibodies Anti-SLC22A13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC22A13 Antibody

상품 한눈에 보기

Human SLC22A13 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 검증됨. OAT10 등 다양한 유전자명으로 알려진 단백질에 반응하며, 고순도 Affinity 정제 방식으로 제조됨. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035962-100 Anti-SLC22A13 Antibody, solute carrier family 22 (organic anion/urate transporter), member 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035962-25 Anti-SLC22A13 Antibody, solute carrier family 22 (organic anion/urate transporter), member 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC22A13 Antibody

Anti-SLC22A13 Antibody

Target: solute carrier family 22 (organic anion/urate transporter), member 13
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC22A13

Alternative Gene Names

OAT10, OCTL1, OCTL3, ORCTL3

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 22 (organic anion/urate transporter), member 13
Target Gene SLC22A13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000056476 (65%), Mouse ENSMUSG00000074028 (59%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.