
Atlas Antibodies Anti-SLC22A13 Antibody
상품 한눈에 보기
Human SLC22A13 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC Orthogonal Validation을 통해 검증됨. OAT10 등 다양한 유전자명으로 알려진 단백질에 반응하며, 고순도 Affinity 정제 방식으로 제조됨. PBS/glycerol buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC22A13 Antibody
Target: solute carrier family 22 (organic anion/urate transporter), member 13
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SLC22A13
Alternative Gene Names
OAT10, OCTL1, OCTL3, ORCTL3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 22 (organic anion/urate transporter), member 13 |
| Target Gene | SLC22A13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000056476 (65%), Mouse ENSMUSG00000074028 (59%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC22A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC22A17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC22A13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC22A15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC22A16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.