
Atlas Antibodies Anti-SLC22A1 Antibody
Human SLC22A1 단백질을 인식하는 토끼 폴리클로날 항체. OCT1로도 알려진 유기 양이온 수송체를 검출. IHC 등 다양한 응용에 사용 가능. PrEST 항원을 이용한 친화 정제 방식. PBS/glycerol buffer에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC22A1 Antibody
Target: solute carrier family 22 (organic cation transporter), member 1
Alternative Gene Name: OCT1
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human SLC22A1 (solute carrier family 22, organic cation transporter, member 1).
Also known as OCT1.
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.
Target Information
- Target Protein: solute carrier family 22 (organic cation transporter), member 1
- Target Gene: SLC22A1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
PRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFIL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016337 | 78% |
| Mouse | ENSMUSG00000023829 | 74% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 맞는 최적 조건은 사용자가 직접 설정해야 합니다.
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC22A11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC1A7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC22A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC20A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC1A5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|