
Atlas Antibodies Anti-SLC16A1 Antibody
인간 SLC16A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. RNA-seq 데이터 기반의 정교한 직교 검증을 거쳤으며, 고순도의 친화 정제 방식으로 제조되었습니다. MCT1 단백질 연구에 활용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC16A1 Antibody
Target: solute carrier family 16 (monocarboxylate transporter), member 1
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human SLC16A1
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human SLC16A1 (solute carrier family 16, monocarboxylate transporter, member 1).
Alternative Gene Names
- MCT
- MCT1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000032902 | 66% |
| Rat | ENSRNOG00000019996 | 65% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC16A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|