
Atlas Antibodies Anti-SLBP Antibody
상품 한눈에 보기
Human SLBP 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 응용에 적합함. Orthogonal 및 Independent validation으로 검증됨. Affinity purification으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLBP Antibody
Target Protein: stem-loop binding protein
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
- WB Independent Validation: 서로 다른 에피토프를 타겟하는 독립 항체 간 비교를 통해 단백질 발현 검증
Product Description
Polyclonal Antibody against Human SLBP
Alternative Gene Names
- HBP
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | stem-loop binding protein |
| Target Gene | SLBP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (91%), Rat (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal conditions should be determined by the user. |
Antigen Sequence
CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLAMF8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLBP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLBP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLAMF7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLAMF6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.