
Atlas Antibodies Anti-SIRPB1 Antibody
상품 한눈에 보기
Human SIRPB1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며, 40% glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SIRPB1 Antibody
Target: Signal-regulatory protein beta 1 (SIRPB1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human SIRPB1.
Also known as CD172b or SIRP-BETA-1.
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
- Target Protein: Signal-regulatory protein beta 1
- Target Gene: SIRPB1
- Alternative Gene Names: CD172b, SIRP-BETA-1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030374 | 34% |
| Rat | ENSRNOG00000000040 | 34% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SIRPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SIRPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SIRPB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SIPA1L3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SIRPA Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.