
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SIRPB1 Antibody
상품 한눈에 보기
Human SIRPB1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며, 40% glycerol buffer에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047463-100 Anti-SIRPB1 Antibody, signal-regulatory protein beta 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047463-25 Anti-SIRPB1 Antibody, signal-regulatory protein beta 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SIRPB1 Antibody
Anti-SIRPB1 Antibody
Target: Signal-regulatory protein beta 1 (SIRPB1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human SIRPB1.
Also known as CD172b or SIRP-BETA-1.
Recommended Applications
- Immunohistochemistry (IHC)
Target Information
- Target Protein: Signal-regulatory protein beta 1
- Target Gene: SIRPB1
- Alternative Gene Names: CD172b, SIRP-BETA-1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VSKSYALEISAHQKEHGSDITHEPALAPTAPL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030374 | 34% |
| Rat | ENSRNOG00000000040 | 34% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



