Atlas Antibodies Anti-SIGLEC11 Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA052132-100 | - | Atlas Antibodies HPA052132-100 Anti-SIGLEC11 Antibody, sialic acid binding Ig like lectin 11 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA052132-25 | - | Atlas Antibodies HPA052132-25 Anti-SIGLEC11 Antibody, sialic acid binding Ig like lectin 11 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-SIGLEC11 Antibody
sialic acid binding Ig like lectin 11
Recommended Applications
Product Description
Polyclonal Antibody against Human SIGLEC11
Target Protein
sialic acid binding Ig like lectin 11
Target Gene
SIGLEC11
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000028599 (37%)
Rat ENSRNOG00000011619 (35%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|