
Atlas Antibodies Anti-SHTN1 Antibody
상품 한눈에 보기
Human SHTN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Independent validation 수행. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(인간-쥐/마우스 95%)을 보임.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SHTN1 Antibody
Target Protein: shootin 1
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human SHTN1 (shootin 1).
Validated for use in immunohistochemistry (IHC) and western blot (WB).
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Independent validation): Protein expression validated using independent antibodies targeting different epitopes.
Alternative Gene Names
KIAA1598, shootin-1, shootin1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | shootin 1 |
| Target Gene | SHTN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000018350 (95%), Mouse ENSMUSG00000041362 (95%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SIDT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SIAH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHTN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHROOM4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHQ1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.