Atlas Antibodies Anti-SHTN1 Antibody

상품 한눈에 보기

Human SHTN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Independent validation 수행. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(인간-쥐/마우스 95%)을 보임.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037942-100 Anti-SHTN1 Antibody, shootin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037942-25 Anti-SHTN1 Antibody, shootin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: shootin 1
Supplier: Atlas Antibodies

Polyclonal antibody against Human SHTN1 (shootin 1).
Validated for use in immunohistochemistry (IHC) and western blot (WB).

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
WB (Independent validation): Protein expression validated using independent antibodies targeting different epitopes.

KIAA1598, shootin-1, shootin1

항목	내용
Target Protein	shootin 1
Target Gene	SHTN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQK
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000018350 (95%), Mouse ENSMUSG00000041362 (95%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)