
Atlas Antibodies Anti-ELP6 Antibody
상품 한눈에 보기
Human ELP6 단백질에 특이적인 폴리클로날 항체. Western blot(WB) 및 Immunohistochemistry(IHC)에 적합. Rabbit에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ELP6 Antibody
Target: elongator acetyltransferase complex subunit 6 (ELP6)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human ELP6, produced in rabbit.
Alternative Gene Names
C3orf75, FLJ20211, TMEM103
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | elongator acetyltransferase complex subunit 6 |
| Target Gene | ELP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ |
Species Reactivity
- Verified: Human
- Ortholog Identity: Mouse (76%), Rat (76%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EMC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EMC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELSPBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELSPBP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.