
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ELP6 Antibody
상품 한눈에 보기
Human ELP6 단백질에 특이적인 폴리클로날 항체. Western blot(WB) 및 Immunohistochemistry(IHC)에 적합. Rabbit에서 생산된 IgG 항체로, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064545-100 Anti-ELP6 Antibody, elongator acetyltransferase complex subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064545-25 Anti-ELP6 Antibody, elongator acetyltransferase complex subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ELP6 Antibody
Anti-ELP6 Antibody
Target: elongator acetyltransferase complex subunit 6 (ELP6)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human ELP6, produced in rabbit.
Alternative Gene Names
C3orf75, FLJ20211, TMEM103
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | elongator acetyltransferase complex subunit 6 |
| Target Gene | ELP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ |
Species Reactivity
- Verified: Human
- Ortholog Identity: Mouse (76%), Rat (76%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



