
Atlas Antibodies Anti-ELP6 Antibody
상품 한눈에 보기
Human ELP6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 제조되었으며, PrEST 항원으로 친화 정제되었습니다. 높은 인간 특이성과 안정적인 PBS/glycerol buffer 포맷을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ELP6 Antibody
Target Information
- Protein: Elongator acetyltransferase complex subunit 6
- Gene: ELP6
- Alternative Gene Names: C3orf75, FLJ20211, TMEM103
Product Description
Polyclonal antibody against human ELP6.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Verified Species Reactivity
- Human
Interspecies Identity
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000054836 | 76% |
| Rat | ENSRNOG00000020847 | 76% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ELSPBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELSPBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELP5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ELP5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.