
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ELP6 Antibody
상품 한눈에 보기
Human ELP6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 호스트에서 제조되었으며, PrEST 항원으로 친화 정제되었습니다. 높은 인간 특이성과 안정적인 PBS/glycerol buffer 포맷을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA046358-100 Anti-ELP6 Antibody, elongator acetyltransferase complex subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046358-25 Anti-ELP6 Antibody, elongator acetyltransferase complex subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ELP6 Antibody
Anti-ELP6 Antibody
Target Information
- Protein: Elongator acetyltransferase complex subunit 6
- Gene: ELP6
- Alternative Gene Names: C3orf75, FLJ20211, TMEM103
Product Description
Polyclonal antibody against human ELP6.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRAEGLATGFCRDVHGQLRILWRRPSQPAVHRDQ
Verified Species Reactivity
- Human
Interspecies Identity
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000054836 | 76% |
| Rat | ENSRNOG00000020847 | 76% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



