
Atlas Antibodies Anti-EIF3K Antibody
상품 한눈에 보기
Human EIF3K 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EIF3K Antibody
Target: eukaryotic translation initiation factor 3, subunit K (EIF3K)
Type: Polyclonal Antibody against Human EIF3K
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against Human EIF3K.
Alternative Gene Names
ARG134, eIF3k, EIF3S12, HSPC029, M9, PLAC-24, PRO1474, PTD001
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | eukaryotic translation initiation factor 3, subunit K |
| Target Gene | EIF3K |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Mouse ENSMUSG00000053565 (100%), Rat ENSRNOG00000020495 (78%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EIF3H Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF3J Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF3K Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF3I Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF3G Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.