
Atlas Antibodies Anti-EIF2AK2 Antibody
상품 한눈에 보기
Human EIF2AK2 단백질을 인식하는 고품질 rabbit polyclonal antibody. WB 및 IHC에 적합하며, 독립 항체 비교를 통한 강화 검증 제공. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 보장.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EIF2AK2 Antibody
Target: eukaryotic translation initiation factor 2-alpha kinase 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human EIF2AK2
Alternative Gene Names
EIF2AK1, PKR, PPP1R83, PRKR
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | eukaryotic translation initiation factor 2-alpha kinase 2 |
| Target Gene | EIF2AK2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (Full) | EFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSN |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000048315 (54%), Mouse ENSMUSG00000024079 (51%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-EIF2B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF2AK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF2AK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF2AK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-EIF2A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.