Atlas Antibodies Anti-EID2B Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA064185-100 | - | Atlas Antibodies HPA064185-100 Anti-EID2B Antibody, EP300 interacting inhibitor of differentiation 2B 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA064185-25 | - | Atlas Antibodies HPA064185-25 Anti-EID2B Antibody, EP300 interacting inhibitor of differentiation 2B 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-EID2B Antibody
EP300 interacting inhibitor of differentiation 2B
Recommended Applications
Product Description
Polyclonal Antibody against Human EID2B
Alternative Gene Names
EID-3, FLJ38944
Target Protein
EP300 interacting inhibitor of differentiation 2B
Target Gene
EID2B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000045545 (56%)
Mouse ENSMUSG00000070705 (53%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|