
Atlas Antibodies Anti-EHMT1 Antibody
상품 한눈에 보기
Human EHMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 고순도의 IgG 형태로 제공됩니다. 40% glycerol 기반 PBS buffer에 보존되어 장기 안정성이 우수합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-EHMT1 Antibody
Target: euchromatic histone-lysine N-methyltransferase 1 (EHMT1)
Type: Polyclonal Antibody against Human EHMT1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human EHMT1 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
bA188C12.1, Eu-HMTase1, FLJ12879, KIAA1876, KMT1D
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | euchromatic histone-lysine N-methyltransferase 1 |
| Target Gene | EHMT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATL |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000007242 (74%), Mouse ENSMUSG00000036893 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
