
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EHMT1 Antibody
상품 한눈에 보기
Human EHMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 고순도의 IgG 형태로 제공됩니다. 40% glycerol 기반 PBS buffer에 보존되어 장기 안정성이 우수합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060022-100 Anti-EHMT1 Antibody, euchromatic histone-lysine N-methyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060022-25 Anti-EHMT1 Antibody, euchromatic histone-lysine N-methyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EHMT1 Antibody
Anti-EHMT1 Antibody
Target: euchromatic histone-lysine N-methyltransferase 1 (EHMT1)
Type: Polyclonal Antibody against Human EHMT1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human EHMT1 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
bA188C12.1, Eu-HMTase1, FLJ12879, KIAA1876, KMT1D
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | euchromatic histone-lysine N-methyltransferase 1 |
| Target Gene | EHMT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATL |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000007242 (74%), Mouse ENSMUSG00000036893 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



