AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EBLN2 Antibody
상품 한눈에 보기
인간 EBLN2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, 인체 시료에 적합합니다. ICC 등 다양한 응용에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062510-100 Anti-EBLN2 Antibody, endogenous Bornavirus-like nucleoprotein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062510-25 Anti-EBLN2 Antibody, endogenous Bornavirus-like nucleoprotein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EBLN2 Antibody
Anti-EBLN2 Antibody
Target: Endogenous Bornavirus-like nucleoprotein 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human EBLN2.
Target Information
- Protein: Endogenous Bornavirus-like nucleoprotein 2
- Gene: EBLN2
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QALLSVGVSKRSNTVVGNENEERGTPYASRFKDMPNFIALEKSSVLRHCCDLLIGIAAGSSDKICTSS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000004455 | 29% |
| Rat | ENSRNOG00000001269 | 29% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.