
Atlas Antibodies Anti-DZANK1 Antibody
상품 한눈에 보기
인간 DZANK1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. Affinity purification으로 높은 특이도 확보. 40% 글리세롤 PBS 버퍼에 보존. 인간에 대해 검증된 반응성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DZANK1 Antibody
Target: double zinc ribbon and ankyrin repeat domains 1 (DZANK1)
Type: Polyclonal antibody against Human DZANK1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against the human DZANK1 protein.
Alternative Gene Names
ANKRD64, bA189K21.8, C20orf12, C20orf84, dJ568F9.2, FLJ10600, FLJ30892
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | double zinc ribbon and ankyrin repeat domains 1 |
| Target Gene | DZANK1 |
| Antigen Sequence | EKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007440 (86%), Mouse ENSMUSG00000037259 (85%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DZIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DZIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DZANK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DZANK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DYX1C1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.