AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DSEL Antibody
상품 한눈에 보기
Human DSEL 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. Glycerol 기반 buffer로 장기 보관이 용이합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060942-100 Anti-DSEL Antibody, dermatan sulfate epimerase-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060942-25 Anti-DSEL Antibody, dermatan sulfate epimerase-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DSEL Antibody
Anti-DSEL Antibody
Target: dermatan sulfate epimerase-like (DSEL)
Type: Polyclonal Antibody against Human DSEL
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DSEL (dermatan sulfate epimerase-like).
Alternative Gene Names
C18orf4, FLJ11477, NCAG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dermatan sulfate epimerase-like |
| Target Gene | DSEL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000038702 (94%), Rat ENSRNOG00000032307 (92%) |
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
WTGEEVGDAAGEIITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.