
Atlas Antibodies Anti-DSEL Antibody
상품 한눈에 보기
Human DSEL 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. Glycerol 기반 buffer로 장기 보관이 용이합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DSEL Antibody
Target: dermatan sulfate epimerase-like (DSEL)
Type: Polyclonal Antibody against Human DSEL
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DSEL (dermatan sulfate epimerase-like).
Alternative Gene Names
C18orf4, FLJ11477, NCAG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dermatan sulfate epimerase-like |
| Target Gene | DSEL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000038702 (94%), Rat ENSRNOG00000032307 (92%) |
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
WTGEEVGDAAGEIITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSAFFHNLDIDFKYIPYKFMNRYNGAMMDVWDA
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
