
Atlas Antibodies Anti-DPYSL5 Antibody
상품 한눈에 보기
Human DPYSL5 단백질을 표적으로 하는 rabbit polyclonal 항체로, IHC 등 단백질 발현 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 높은 종간 보존성과 특이성을 지닌 신뢰성 높은 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DPYSL5 Antibody
Target: dihydropyrimidinase-like 5 (DPYSL5)
Type: Polyclonal Antibody against Human DPYSL5
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody targeting Human DPYSL5, validated for use in immunohistochemistry and related applications.
Alternative Gene Names
CRAM, CRMP-5, CRMP5, Ulip6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dihydropyrimidinase-like 5 |
| Target Gene | DPYSL5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000054165 (98%), Mouse ENSMUSG00000029168 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DPYS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPY30 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPYSL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPY19L3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DPY19L2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.