
Atlas Antibodies Anti-SHCBP1L Antibody
상품 한눈에 보기
Human SHCBP1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 직교 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와도 유사성 있음.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SHCBP1L Antibody
SHC SH2-domain binding protein 1-like
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human SHCBP1L.
Alternative Gene Names
- C1orf14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SHC SH2-domain binding protein 1-like |
| Target Gene | SHCBP1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000002691 | 79% |
| Mouse | ENSMUSG00000042708 | 76% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SHD Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHKBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHCBP1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SHCBP1L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.