Atlas Antibodies Anti-SFPQ Antibody
상품 한눈에 보기
Human SFPQ 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC 및 WB 검증 완료. siRNA knockdown을 통한 유전적 검증 제공. Rabbit 호스트 기반, PrEST 항원으로 정제된 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SFPQ Antibody
splicing factor proline/glutamine-rich
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.WB (Genetic Validation)
Genetic validation in Western blot (WB) by siRNA knockdown.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SFPQ
Alternative Gene Names
PPP1R140, PSF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | splicing factor proline/glutamine-rich |
| Target Gene | SFPQ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000058461 (100%), Mouse ENSMUSG00000028820 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.