
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SFPQ Antibody
상품 한눈에 보기
Human SFPQ 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC 및 WB 검증 완료. siRNA knockdown을 통한 유전적 검증 제공. Rabbit 호스트 기반, PrEST 항원으로 정제된 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054689-100 Anti-SFPQ Antibody, splicing factor proline/glutamine-rich 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054689-25 Anti-SFPQ Antibody, splicing factor proline/glutamine-rich 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SFPQ Antibody
Anti-SFPQ Antibody
splicing factor proline/glutamine-rich
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.WB (Genetic Validation)
Genetic validation in Western blot (WB) by siRNA knockdown.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SFPQ
Alternative Gene Names
PPP1R140, PSF
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | splicing factor proline/glutamine-rich |
| Target Gene | SFPQ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000058461 (100%), Mouse ENSMUSG00000028820 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



