CacheBy
Atlas Antibodies Anti-SFPQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SFPQ Antibody

상품 한눈에 보기

Human SFPQ 단백질을 타겟으로 하는 고품질 폴리클로날 항체. IHC 및 WB 검증 완료. siRNA knockdown을 통한 유전적 검증 제공. Rabbit 호스트 기반, PrEST 항원으로 정제된 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054689-100 Anti-SFPQ Antibody, splicing factor proline/glutamine-rich 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054689-25 Anti-SFPQ Antibody, splicing factor proline/glutamine-rich 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SFPQ Antibody

Anti-SFPQ Antibody

splicing factor proline/glutamine-rich


  • IHC (Independent Validation)
    Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Genetic Validation)
    Genetic validation in Western blot (WB) by siRNA knockdown.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human SFPQ


Alternative Gene Names

PPP1R140, PSF

Open Datasheet


Target Information

항목 내용
Target Protein splicing factor proline/glutamine-rich
Target Gene SFPQ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000058461 (100%), Mouse ENSMUSG00000028820 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.