CacheBy
Atlas Antibodies Anti-SETD1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SETD1A Antibody

상품 한눈에 보기

Human SETD1A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. 다양한 연구 응용에 유용.

카탈로그번호
HPA058376-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058376-100 Anti-SETD1A Antibody, SET domain containing 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058376-25 Anti-SETD1A Antibody, SET domain containing 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SETD1A Antibody

Anti-SETD1A Antibody

SET domain containing 1A


  • Independent antibody validation in IHC
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human SETD1A


Alternative Gene Names

KIAA0339, KMT2F, Set1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SET domain containing 1A
Target Gene SETD1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to orthologs: Rat (ENSRNOG00000055028, 89%), Mouse (ENSMUSG00000042308, 88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.