
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SETD1A Antibody
상품 한눈에 보기
Human SETD1A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. 다양한 연구 응용에 유용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058376-100 Anti-SETD1A Antibody, SET domain containing 1A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058376-25 Anti-SETD1A Antibody, SET domain containing 1A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SETD1A Antibody
Anti-SETD1A Antibody
SET domain containing 1A
Recommended Applications
- Independent antibody validation in IHC
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human SETD1A
Alternative Gene Names
KIAA0339, KMT2F, Set1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SET domain containing 1A |
| Target Gene | SETD1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREEPPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYRPPASEA |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to orthologs: Rat (ENSRNOG00000055028, 89%), Mouse (ENSMUSG00000042308, 88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



