
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SERPINB6 Antibody
상품 한눈에 보기
Human SERPINB6 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 특이적 반응성을 보이며, 연구용으로 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA012736-100 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012736-25 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SERPINB6 Antibody
Anti-SERPINB6 Antibody
Target: serpin peptidase inhibitor, clade B (ovalbumin), member 6
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal Antibody against Human SERPINB6
Alternative Gene Names
CAP, DFNB91, PI6, PTI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | serpin peptidase inhibitor, clade B (ovalbumin), member 6 |
| Target Gene | SERPINB6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSV |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000060147 (75%), Rat ENSRNOG00000016420 (71%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Material Safety Data Sheet | MSDS - Sodium Azide |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



