CacheBy
Atlas Antibodies Anti-SERPINB6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINB6 Antibody

상품 한눈에 보기

Human SERPINB6 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 특이적 반응성을 보이며, 연구용으로 적합.

카탈로그번호
HPA012736-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012736-100 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012736-25 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINB6 Antibody

Anti-SERPINB6 Antibody

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 6
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Immunocytochemistry application supported.

Product Description

Polyclonal Antibody against Human SERPINB6


Alternative Gene Names

CAP, DFNB91, PI6, PTI

Open Datasheet


Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade B (ovalbumin), member 6
Target Gene SERPINB6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000060147 (75%), Rat ENSRNOG00000016420 (71%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.