Atlas Antibodies Anti-SERPINB6 Antibody

상품 한눈에 보기

Human SERPINB6 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 특이적 반응성을 보이며, 연구용으로 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기

Atlas Antibodies HPA012736-100 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA012736-25 Anti-SERPINB6 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SERPINB6 Antibody

Anti-SERPINB6 Antibody

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 6
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Immunocytochemistry application supported.

Product Description

Polyclonal Antibody against Human SERPINB6

Alternative Gene Names

CAP, DFNB91, PI6, PTI

Open Datasheet

Target Information

항목	내용
Target Protein	serpin peptidase inhibitor, clade B (ovalbumin), member 6
Target Gene	SERPINB6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSV
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000060147 (75%), Rat ENSRNOG00000016420 (71%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Material Safety Data Sheet	MSDS - Sodium Azide