Atlas Antibodies Anti-SERPINA1 Antibody
상품 한눈에 보기
인간 SERPINA1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 검증됨. 독립 항체 및 RNA-seq 데이터 기반 정교한 검증 수행. 친화성 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SERPINA1 Antibody
Target: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Independent antibody validation (WB): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal antibody against Human SERPINA1.
Alternative Gene Names: A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 |
| Target Gene | SERPINA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000032669 (67%), Mouse ENSMUSG00000071178 (62%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-SERPINA3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SERPINA10 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SERPINA1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SERGEF Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-SERPINA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.