CacheBy
Atlas Antibodies Anti-SERPINA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINA1 Antibody

상품 한눈에 보기

인간 SERPINA1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 검증됨. 독립 항체 및 RNA-seq 데이터 기반 정교한 검증 수행. 친화성 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA001292-100 Anti-SERPINA1 Antibody, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001292-25 Anti-SERPINA1 Antibody, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINA1 Antibody

Anti-SERPINA1 Antibody

Target: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Independent antibody validation (WB): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human SERPINA1.

Alternative Gene Names: A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Target Gene SERPINA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000032669 (67%), Mouse ENSMUSG00000071178 (62%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.