Atlas Antibodies Anti-SERPINA1 Antibody

상품 한눈에 보기

인간 SERPINA1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 검증됨. 독립 항체 및 RNA-seq 데이터 기반 정교한 검증 수행. 친화성 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그번호: HPA001292-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001292-100 Anti-SERPINA1 Antibody, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001292-25 Anti-SERPINA1 Antibody, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SERPINA1 Antibody

Anti-SERPINA1 Antibody

Target: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Independent antibody validation (WB): Protein expression validated by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against Human SERPINA1.

Alternative Gene Names: A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Target Gene	SERPINA1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000032669 (67%), Mouse ENSMUSG00000071178 (62%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR