
Atlas Antibodies Anti-SEPT1 Antibody
Human SEPT1 단백질을 표적으로 하는 폴리클론 항체로, IHC 및 WB에서 검증된 높은 특이성과 재현성을 제공합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되어 안정적입니다. 다양한 조직에서 RNA-seq 데이터와 비교한 정교한 Orthogonal Validation 지원.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SEPT1 Antibody
Target: septin 1
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human SEPT1
Alternative Gene Names
DIFF6, PNUTL3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | septin 1 |
| Target Gene | SEPT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000000486 (100%), Rat ENSRNOG00000017804 (100%) |
Antigen Sequence:EVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SEPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPHS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPHS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SEPSECS Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|