
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SENP3 Antibody
상품 한눈에 보기
Human SENP3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증되었으며 Rat, Mouse와 높은 서열 유사성 보유. 40% glycerol 기반 PBS buffer에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA060290-100 Anti-SENP3 Antibody, SUMO1/sentrin/SMT3 specific peptidase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060290-25 Anti-SENP3 Antibody, SUMO1/sentrin/SMT3 specific peptidase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SENP3 Antibody
Anti-SENP3 Antibody
Target: SUMO1/sentrin/SMT3 specific peptidase 3 (SENP3)
Type: Polyclonal Antibody against Human SENP3
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against the human SENP3 protein.
Alternative Gene Names
DKFZP586K0919, DKFZp762A152, SMT3IP1, SSP3, Ulp1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SUMO1/sentrin/SMT3 specific peptidase 3 |
| Target Gene | SENP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000013746 (98%)
- Mouse ENSMUSG00000005204 (98%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



