CacheBy
Atlas Antibodies Anti-SEMA7A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEMA7A Antibody

상품 한눈에 보기

Human SEMA7A 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 orthogonal validation 적용. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. Human 반응성 검증 완료.

카탈로그번호
HPA042273-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042273-100 Anti-SEMA7A Antibody, semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042273-25 Anti-SEMA7A Antibody, semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEMA7A Antibody

Anti-SEMA7A Antibody

Target: semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SEMA7A

Alternative Gene Names

CD108, H-Sema-L, SEMAL

Open Datasheet

Target Information

항목 내용
Target Protein semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Target Gene SEMA7A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007687 (87%), Mouse ENSMUSG00000038264 (85%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.