
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SEMA7A Antibody
상품 한눈에 보기
Human SEMA7A 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 orthogonal validation 적용. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. Human 반응성 검증 완료.
- 카탈로그번호
- HPA042273-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042273-100 Anti-SEMA7A Antibody, semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042273-25 Anti-SEMA7A Antibody, semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SEMA7A Antibody
Anti-SEMA7A Antibody
Target: semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SEMA7A
Alternative Gene Names
CD108, H-Sema-L, SEMAL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Target Gene | SEMA7A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000007687 (87%), Mouse ENSMUSG00000038264 (85%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



