CacheBy
Atlas Antibodies Anti-SEMA4D Antibody
원본

Atlas Antibodies Anti-SEMA4D Antibody

상품 한눈에 보기

Human SEMA4D 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성을 보입니다. PBS와 글리세롤 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA015662-100 Anti-SEMA4D Antibody, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015662-25 Anti-SEMA4D Antibody, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEMA4D Antibody

Anti-SEMA4D Antibody

Human SEMA4D 단백질을 인식하는 Rabbit Polyclonal 항체입니다.
SEMA4D는 sema domain, immunoglobulin domain (Ig), transmembrane domain (TM), short cytoplasmic domain으로 구성된 semaphorin 계열 단백질입니다.


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human SEMA4D


Alternative Gene Names

C9orf164, CD100, coll-4, FLJ39737, SEMAJ

Open Datasheet


Target Information

항목 내용
Target Protein sema domain, immunoglobulin domain (Ig), transmembrane domain (TM), short cytoplasmic domain, (semaphorin) 4D
Target Gene SEMA4D
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Mouse ENSMUSG00000021451 (92%)
    • Rat ENSRNOG00000013679 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.