CacheBy
Atlas Antibodies Anti-SCPEP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCPEP1 Antibody

상품 한눈에 보기

Human SCPEP1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 정제되었으며 Human, Mouse, Rat에 반응합니다. 40% glycerol/PBS buffer로 안정화되어 장기간 보관이 가능합니다.

카탈로그번호
HPA039102-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039102-100 Anti-SCPEP1 Antibody, serine carboxypeptidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039102-25 Anti-SCPEP1 Antibody, serine carboxypeptidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCPEP1 Antibody

Anti-SCPEP1 Antibody

Target: Serine carboxypeptidase 1 (SCPEP1)
Type: Polyclonal Antibody against Human SCPEP1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human SCPEP1.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • RISC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Serine carboxypeptidase 1
Target Gene SCPEP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KPVISIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQQ

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000002358 85%
Mouse ENSMUSG00000000278 82%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.