CacheBy
Atlas Antibodies Anti-SCNN1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCNN1A Antibody

상품 한눈에 보기

인간 SCNN1A 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 Orthogonal 검증을 거침. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫트와 높은 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA012743-100 Anti-SCNN1A Antibody, sodium channel, non-voltage-gated 1 alpha subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012743-25 Anti-SCNN1A Antibody, sodium channel, non-voltage-gated 1 alpha subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCNN1A Antibody

Anti-SCNN1A Antibody

Target: Sodium channel, non-voltage-gated 1 alpha subunit
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SCNN1A


Alternative Gene Names

  • ENaCalpha
  • SCNN1

Open Datasheet


Target Information

항목 내용
Target Protein Sodium channel, non-voltage-gated 1 alpha subunit
Target Gene SCNN1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (78%), Rat (76%)

Antigen Sequence:
RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.