
Atlas Antibodies Anti-SCNN1A Antibody
상품 한눈에 보기
인간 SCNN1A 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 Orthogonal 검증을 거침. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫트와 높은 서열 동일성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SCNN1A Antibody
Target: Sodium channel, non-voltage-gated 1 alpha subunit
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SCNN1A
Alternative Gene Names
- ENaCalpha
- SCNN1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Sodium channel, non-voltage-gated 1 alpha subunit |
| Target Gene | SCNN1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (78%), Rat (76%) |
Antigen Sequence:
RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SCNM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCN8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCNN1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCN8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCN9A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.