AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DPP6 Antibody
상품 한눈에 보기
Human DPP6 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB에 적합. 고순도 Affinity 정제 제품이며 Human과 Mouse 반응성이 검증됨. 안정적인 PBS/glycerol buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050509-100 Anti-DPP6 Antibody, dipeptidyl-peptidase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050509-25 Anti-DPP6 Antibody, dipeptidyl-peptidase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPP6 Antibody
Anti-DPP6 Antibody
Target: dipeptidyl-peptidase 6 (DPP6)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human DPP6
Alternative Gene Names
- DPPX
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dipeptidyl-peptidase 6 |
| Target Gene | DPP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Identity | Mouse ENSMUSG00000061576 (86%), Rat ENSRNOG00000030547 (86%) |
Antigen Sequence:
VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.