Atlas Antibodies Anti-DPP4 Antibody

상품 한눈에 보기

Human DPP4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. ADCP2, CD26, DPPIV 유전자 대체명으로 알려진 DPP4 타깃에 특이적이며, PrEST 항원을 이용해 친화정제되었습니다. Human에 반응하며, 보존액으로 40% glycerol과 PBS(pH 7.2)를 포함합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071236-100 Anti-DPP4 Antibody, dipeptidyl peptidase 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071236-25 Anti-DPP4 Antibody, dipeptidyl peptidase 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DPP4 Antibody

Anti-DPP4 Antibody

Target Information

Target Protein: dipeptidyl peptidase 4
Target Gene: DPP4
Alternative Gene Names: ADCP2, CD26, DPPIV

Product Description

Polyclonal antibody against Human DPP4 (dipeptidyl peptidase 4).
Recommended for use in immunohistochemistry (IHC) and western blotting (WB).

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP

Species Reactivity

Verified Species: Human
Interspecies Identity:
- Rat (ENSRNOG00000030763): 83%
- Mouse (ENSMUSG00000035000): 83%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet