AI 생성

1 / 2

Atlas Antibodies Anti-DPP3 Antibody

상품 한눈에 보기

인체 DPP3 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 인간 및 설치류 간 높은 항원 서열 유사성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035780-100 Anti-DPP3 Antibody, dipeptidyl-peptidase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035780-25 Anti-DPP3 Antibody, dipeptidyl-peptidase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dipeptidyl-peptidase 3 (DPP3)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Western Blot (WB, Independent Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Polyclonal antibody against Human DPP3

항목	내용
Target Protein	dipeptidyl-peptidase 3
Target Gene	DPP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000031485 (95%), Mouse ENSMUSG00000063904 (95%)

Antigen Sequence:

EGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.