Atlas Antibodies Anti-DPP3 Antibody

상품 한눈에 보기

Human DPP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 보장. 인간에 대한 검증 완료, 설치류와 높은 상동성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035781-100 Anti-DPP3 Antibody, dipeptidyl-peptidase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035781-25 Anti-DPP3 Antibody, dipeptidyl-peptidase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dipeptidyl-peptidase 3 (DPP3)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, independently validated)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against Human DPP3.
Validated for multiple applications with high specificity and reproducibility.

항목	내용
Target Protein	dipeptidyl-peptidase 3
Target Gene	DPP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000031485 (95%), Mouse ENSMUSG00000063904 (95%)

Antigen Sequence:
EGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet