CacheBy
Atlas Antibodies Anti-DPP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPP4 Antibody

상품 한눈에 보기

Human DPP4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 응용에 적합합니다. ADCP2, CD26, DPPIV 유전자의 대체명과 교차 반응성이 검증되었습니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068778-100 Anti-DPP4 Antibody, dipeptidyl peptidase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068778-25 Anti-DPP4 Antibody, dipeptidyl peptidase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPP4 Antibody

Anti-DPP4 Antibody

Target Protein: dipeptidyl peptidase 4 (DPP4)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DPP4 protein.

Alternative Gene Names

ADCP2, CD26, DPPIV

Open Datasheet

Target Information

항목 내용
Target Protein dipeptidyl peptidase 4
Target Gene DPP4
Verified Species Reactivity Human
Interspecies Information Mouse (83%), Rat (83%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.