원본

Atlas Antibodies Anti-DPM1 Antibody

상품 한눈에 보기

Human DPM1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 쥐 및 마우스에서 유사성이 확인되었습니다.

카탈로그번호: HPA051818-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051818-100 Anti-DPM1 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051818-25 Anti-DPM1 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DPM1 Antibody

Anti-DPM1 Antibody

Target: dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
Type: Polyclonal Antibody against Human DPM1

Recommended Applications

Immunohistochemistry (IHC)

Product Description

This polyclonal antibody specifically targets the human DPM1 (dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit). It is affinity purified using the PrEST antigen as the affinity ligand.

Alternative Gene Names

CDGIE
MPDS

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
Target Gene	DPM1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000010993 (81%), Mouse ENSMUSG00000093752 (78%)