
원본
Atlas Antibodies Anti-DPM1 Antibody
상품 한눈에 보기
Human DPM1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증되었으며, 쥐 및 마우스에서 유사성이 확인되었습니다.
- 카탈로그번호
- HPA051818-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051818-100 Anti-DPM1 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051818-25 Anti-DPM1 Antibody, dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DPM1 Antibody
Anti-DPM1 Antibody
Target: dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
Type: Polyclonal Antibody against Human DPM1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
This polyclonal antibody specifically targets the human DPM1 (dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit). It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- CDGIE
- MPDS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit |
| Target Gene | DPM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSD |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010993 (81%), Mouse ENSMUSG00000093752 (78%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



