
Atlas Antibodies Anti-DNAJC9 Antibody
Human DNAJC9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 사용 가능. 독립 항체 비교 검증을 통해 높은 신뢰도의 단백질 발현 검증 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DNAJC9 Antibody
DnaJ (Hsp40) homolog, subfamily C, member 9
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Independent validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human DNAJC9
Alternative Gene Names
JDD1, SB73
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DnaJ (Hsp40) homolog, subfamily C, member 9 |
| Target Gene | DNAJC9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT |
Species Reactivity
- Human
- Mouse
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000006619 (93%)
- Mouse ENSMUSG00000021811 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DNAJC8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC5G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|