CacheBy
Atlas Antibodies Anti-DNAJC9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DNAJC9 Antibody

상품 한눈에 보기

Human DNAJC9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 사용 가능. 독립 항체 비교 검증을 통해 높은 신뢰도의 단백질 발현 검증 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035215-100 Anti-DNAJC9 Antibody, DnaJ (Hsp40) homolog, subfamily C, member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035215-25 Anti-DNAJC9 Antibody, DnaJ (Hsp40) homolog, subfamily C, member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DNAJC9 Antibody

Anti-DNAJC9 Antibody

DnaJ (Hsp40) homolog, subfamily C, member 9


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
  • Immunocytochemistry (ICC)

Independent validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human DNAJC9


Alternative Gene Names

JDD1, SB73

Open Datasheet


Target Information

항목 내용
Target Protein DnaJ (Hsp40) homolog, subfamily C, member 9
Target Gene DNAJC9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYT

Species Reactivity

  • Human
  • Mouse

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000006619 (93%)
  • Mouse ENSMUSG00000021811 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Independent
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.