
Atlas Antibodies Anti-DNAJC17 Antibody
상품 한눈에 보기
인간 DNAJC17 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 siRNA 노크다운으로 유전적 검증 완료. 고순도의 친화정제 항체로 인간, 마우스, 랫트 반응성 확인. PBS와 글리세롤 기반 안정화 버퍼 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DNAJC17 Antibody
DnaJ (Hsp40) homolog, subfamily C, member 17
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Genetic validation in WB by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DNAJC17.
Alternative Gene Names
- FLJ10634
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DnaJ (Hsp40) homolog, subfamily C, member 17 |
| Target Gene | DNAJC17 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000012368 (84%)
- Mouse ENSMUSG00000034278 (82%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DNAJC17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJC16 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.