
Atlas Antibodies Anti-DNAJB13 Antibody
상품 한눈에 보기
Human DNAJB13 단백질을 표적으로 하는 토끼 다클론 항체로, IHC 및 WB 검증을 통해 신뢰성 확보. RSPH16A/TSARG6 유전자 대체명 포함. PrEST 항원으로 친화 정제되었으며 PBS/glycerol buffer에 보존됨. 인간 시료에 특이적 반응.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DNAJB13 Antibody
DnaJ (Hsp40) homolog, subfamily B, member 13
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human DNAJB13
Alternative Gene Names
RSPH16A, TSARG6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DnaJ (Hsp40) homolog, subfamily B, member 13 |
| Target Gene | DNAJB13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGE |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017975 (94%), Mouse ENSMUSG00000030708 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DNAJB14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJB13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJB12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DNAJB13 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.