
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DNAH12 Antibody
상품 한눈에 보기
Human DNAH12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. PrEST 항원을 이용해 친화 정제되었으며, 휴먼 반응성이 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061365-100 Anti-DNAH12 Antibody, dynein, axonemal, heavy chain 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061365-25 Anti-DNAH12 Antibody, dynein, axonemal, heavy chain 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DNAH12 Antibody
Anti-DNAH12 Antibody
Target: dynein, axonemal, heavy chain 12
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human DNAH12.
Alternative Gene Names
DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dynein, axonemal, heavy chain 12 |
| Target Gene | DNAH12 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000059865 (83%), Mouse ENSMUSG00000021879 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



