AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DMP1 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human DMP1 (dentin matrix acidic phosphoprotein 1). Affinity purified using PrEST antigen. Suitable for IHC and other research applications. Verified reactivity in human with cross-species similarity to rat and mouse.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037465-100 Anti-DMP1 Antibody, dentin matrix acidic phosphoprotein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037465-25 Anti-DMP1 Antibody, dentin matrix acidic phosphoprotein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DMP1 Antibody
Anti-DMP1 Antibody
Target: dentin matrix acidic phosphoprotein 1 (DMP1)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human DMP1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dentin matrix acidic phosphoprotein 1 |
| Target Gene | DMP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (63%), Mouse (61%) |
Antigen Sequence:
QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.