Atlas Antibodies Anti-DMP1 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human DMP1 (dentin matrix acidic phosphoprotein 1). Affinity purified using PrEST antigen. Suitable for IHC and other research applications. Verified reactivity in human with cross-species similarity to rat and mouse.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DMP1 Antibody
Target: dentin matrix acidic phosphoprotein 1 (DMP1)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human DMP1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dentin matrix acidic phosphoprotein 1 |
| Target Gene | DMP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (63%), Mouse (61%) |
Antigen Sequence:
QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.