Atlas Antibodies Anti-DLEC1 Antibody

상품 한눈에 보기

Human DLEC1 단백질을 인식하는 토끼 폴리클로날 항체로, 폐 및 식도암 관련 단백질 연구에 적합함. IHC 및 ICC 응용에 권장되며 RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체.

카탈로그번호: HPA019077-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019077-100 Anti-DLEC1 Antibody, deleted in lung and esophageal cancer 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019077-25 Anti-DLEC1 Antibody, deleted in lung and esophageal cancer 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DLEC1 Antibody

Anti-DLEC1 Antibody

Target Description:
Deleted in lung and esophageal cancer 1 (DLEC1)

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues

Product Description

Polyclonal antibody against human DLEC1.

Alternative Gene Names

CFAP81, DLC1

Open Datasheet

Antigen Information

Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN

Species Reactivity

Verified: Human
Interspecies Identity:
- Mouse ENSMUSG00000038060 (58%)
- Rat ENSRNOG00000032085 (56%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.