
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DLEC1 Antibody
상품 한눈에 보기
Human DLEC1 단백질을 인식하는 토끼 폴리클로날 항체로, 폐 및 식도암 관련 단백질 연구에 적합함. IHC 및 ICC 응용에 권장되며 RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019077-100 Anti-DLEC1 Antibody, deleted in lung and esophageal cancer 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019077-25 Anti-DLEC1 Antibody, deleted in lung and esophageal cancer 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DLEC1 Antibody
Anti-DLEC1 Antibody
Target Description:
Deleted in lung and esophageal cancer 1 (DLEC1)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues
Product Description
Polyclonal antibody against human DLEC1.
Alternative Gene Names
CFAP81, DLC1
Antigen Information
Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Mouse ENSMUSG00000038060 (58%)
- Rat ENSRNOG00000032085 (56%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



