
Atlas Antibodies Anti-DIP2B Antibody
상품 한눈에 보기
Human DIP2B 단백질을 인식하는 Rabbit Polyclonal 항체. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, Rat 및 Mouse와 높은 서열 유사성 보유. 안정화된 글리세롤/PBS 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DIP2B Antibody
Target: disco-interacting protein 2 homolog B (DIP2B)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human DIP2B protein.
Alternative Gene Names
FLJ34278, KIAA1463
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | disco-interacting protein 2 homolog B |
| Target Gene | DIP2B |
| Antigen Sequence | EKKRSKLLSPYSPQTQETDSAVQKELRNQTPAPSAAQTSAPSKYHRTRSGGARDERY |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000056106 | 91% |
| Mouse | ENSMUSG00000023026 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Recommended Applications
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DIP2C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIP2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIP2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIEXF Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIMT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.