
Atlas Antibodies Anti-DHX8 Antibody
상품 한눈에 보기
Human DHX8 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC 등 다양한 응용에 적합. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DHX8 Antibody
DEAH (Asp-Glu-Ala-His) box polypeptide 8
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
- Genetic validation in WB by siRNA knockdown
Product Description
Polyclonal Antibody against Human DHX8
Alternative Gene Names
DDX8, HRH1, PRP22, PRPF22
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DEAH (Asp-Glu-Ala-His) box polypeptide 8 |
| Target Gene | DHX8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000020772 (100%), Mouse ENSMUSG00000034931 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DIAPH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DICER1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DHX8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIAPH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DIAPH1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.