CacheBy
Atlas Antibodies Anti-DFFB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DFFB Antibody

상품 한눈에 보기

인간 DFFB 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광 등 다양한 연구용 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052904-100 Anti-DFFB Antibody, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052904-25 Anti-DFFB Antibody, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DFFB Antibody

Anti-DFFB Antibody

Target: DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)

면역세포화학(ICC) 등 다양한 응용에 사용 가능.

Product Description

Polyclonal antibody against Human DFFB.

Alternative Gene Names

CAD, CPAN, DFF-40, DFF40

Open Datasheet (PDF)

Target Information

  • Target Protein: DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
  • Target Gene: DFFB
  • Antigen Sequence:
    EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
    (Recombinant Protein Epitope Signature Tag, PrEST antigen sequence)

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000029027 84%
Rat ENSRNOG00000025030 81%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 실험 목적에 맞게 설정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.