AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DESI2 Antibody
상품 한눈에 보기
Human DESI2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purified 방식으로 정제되었으며, ICC 등 다양한 응용에 적합. 40% glycerol과 PBS buffer에 보존되어 안정적. Human에 대해 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049950-100 Anti-DESI2 Antibody, desumoylating isopeptidase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049950-25 Anti-DESI2 Antibody, desumoylating isopeptidase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DESI2 Antibody
Anti-DESI2 Antibody
Target Protein: desumoylating isopeptidase 2 (DESI2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human DESI2, also known as desumoylating isopeptidase 2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Gene | DESI2 |
| Target Protein | desumoylating isopeptidase 2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 100% (ENSMUSG00000111522) Rat: 99% (ENSRNOG00000004524) |
Antigen Sequence:
VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYBuffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.