Atlas Antibodies Anti-DESI2 Antibody
상품 한눈에 보기
Human DESI2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purified 방식으로 정제되었으며, ICC 등 다양한 응용에 적합. 40% glycerol과 PBS buffer에 보존되어 안정적. Human에 대해 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DESI2 Antibody
Target Protein: desumoylating isopeptidase 2 (DESI2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human DESI2, also known as desumoylating isopeptidase 2.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
C1orf121, CGI-146, FAM152A, FLJ21998, PNAS-4, PPPDE1
Target Information
| 항목 | 내용 |
|---|---|
| Target Gene | DESI2 |
| Target Protein | desumoylating isopeptidase 2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 100% (ENSMUSG00000111522) Rat: 99% (ENSRNOG00000004524) |
Antigen Sequence:
VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYBuffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.