Thermo Fisher Scientific ITGB3BP Polyclonal Antibody

Applications

• Western Blot (WB): 0.2–1 µg/mL

Product Specifications

Product Specific Information

• Peptide sequence: TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE
• Sequence homology: Human: 100%

Target Information

ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions.
Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.
ITGB3BP acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1.
It induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases.
ITGB3BP may also act as an inhibitor of cyclin A-associated kinase and may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)