
Atlas Antibodies Anti-SCAMP4 Antibody
상품 한눈에 보기
휴먼 SCAMP4 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 인간에 대한 검증 완료 및 교차 반응 정보 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SCAMP4 Antibody
Target: Secretory carrier membrane protein 4 (SCAMP4)
Type: Polyclonal Antibody against Human SCAMP4
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human SCAMP4, validated for multiple applications. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- FLJ33847
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Secretory carrier membrane protein 4 |
| Target Gene | SCAMP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP |
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000018271 (87%)
- Mouse ENSMUSG00000035370 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SCARA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCAMP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCAPER Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCAPER Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.