CacheBy
Atlas Antibodies Anti-SCAMP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCAMP4 Antibody

상품 한눈에 보기

휴먼 SCAMP4 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 실험에 적합. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 인간에 대한 검증 완료 및 교차 반응 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043284-100 Anti-SCAMP4 Antibody, secretory carrier membrane protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043284-25 Anti-SCAMP4 Antibody, secretory carrier membrane protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCAMP4 Antibody

Anti-SCAMP4 Antibody

Target: Secretory carrier membrane protein 4 (SCAMP4)
Type: Polyclonal Antibody against Human SCAMP4


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human SCAMP4, validated for multiple applications. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ33847

Target Information

항목 내용
Target Protein Secretory carrier membrane protein 4
Target Gene SCAMP4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KVHRIYRGAGGSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Rat ENSRNOG00000018271 (87%)
    • Mouse ENSMUSG00000035370 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.