CacheBy
Atlas Antibodies Anti-SART1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SART1 Antibody

상품 한눈에 보기

인체 SART1 단백질에 대한 고품질 폴리클로날 항체. 면역조직화학(IHC), 웨스턴블롯(WB), 면역세포화학(ICC)에 적합. 토끼 호스트에서 생산되었으며 친화 정제 방식으로 높은 특이성과 재현성 제공. 사람에 대한 반응성 검증 완료.

카탈로그번호
HPA031189-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031189-100 Anti-SART1 Antibody, squamous cell carcinoma antigen recognized by T cells 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031189-25 Anti-SART1 Antibody, squamous cell carcinoma antigen recognized by T cells 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SART1 Antibody

Anti-SART1 Antibody

Target: Squamous cell carcinoma antigen recognized by T cells (SART1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SART1.

Alternative Gene Names

Ara1, SNRNP110, Snu66

Open Datasheet (PDF)

Target Information

  • Target Protein: Squamous cell carcinoma antigen recognized by T cells
  • Target Gene: SART1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000020475 (92%)
  • Mouse ENSMUSG00000039148 (91%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.