CacheBy
Atlas Antibodies Anti-SARS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SARS Antibody

상품 한눈에 보기

Human SARS 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA016939-100 Anti-SARS Antibody, seryl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016939-25 Anti-SARS Antibody, seryl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SARS Antibody

Anti-SARS Antibody

Product Description

Polyclonal antibody against Human SARS (seryl-tRNA synthetase).
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).

Alternative Gene Names

SERS

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein seryl-tRNA synthetase
Target Gene SARS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYAL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000068739 (95%), Rat ENSRNOG00000020255 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.