CacheBy
Atlas Antibodies Anti-SACM1L Antibody
원본

Atlas Antibodies Anti-SACM1L Antibody

상품 한눈에 보기

Human SACM1L 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 특이성과 재현성을 제공. 40% 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069869-100 Anti-SACM1L Antibody, SAC1 suppressor of actin mutations 1-like (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069869-25 Anti-SACM1L Antibody, SAC1 suppressor of actin mutations 1-like (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SACM1L Antibody

Anti-SACM1L Antibody

SAC1 suppressor of actin mutations 1-like (yeast)

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human SACM1L

Alternative Gene Names

KIAA0851, SAC1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein SAC1 suppressor of actin mutations 1-like (yeast)
Target Gene SACM1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000005149 93%
Mouse ENSMUSG00000025240 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.